General Information

  • ID:  hor006500
  • Uniprot ID:  Q9W4Z4
  • Protein name:  Probable insulin-like peptide 6 A chain
  • Gene name:  Ilp6
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Expressed at a low level in the larval gut.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005158 insulin receptor binding
  • GO BP:  GO:0008286 insulin receptor signaling pathway; GO:0009267 cellular response to starvation; GO:0040018 positive regulation of multicellular organism growth; GO:0042594 response to starvation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  DLQNVTDLCCKSGGCTYRELLQYCKG
  • Length:  26(82-107)
  • Propeptide:  MVLKVPTSKVLLVLATLFAVAAMISSWMPQVAASPLAPTEYEQRRMMCSTGLSDVIQKICVSGTVALGDVFPNSFGKRRKRDLQNVTDLCCKSGGCTYRELLQYCKG
  • Signal peptide:  MVLKVPTSKVLLVLATLFAVAAMISSWMPQVAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  InR
  • Target Unid:  P09208
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45915
  • Structure ID:  AF-Q9W4Z4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006500_AF2.pdbhor006500_ESM.pdb

Physical Information

Mass: 335746 Formula: C121H196N34O41S4
Absent amino acids: AFHIMPW Common amino acids: CL
pI: 6.16 Basic residues: 3
Polar residues: 13 Hydrophobic residues: 5
Hydrophobicity: -38.08 Boman Index: -4515
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 71.15
Instability Index: 3604.23 Extinction Coefficient cystines: 3230
Absorbance 280nm: 129.2

Literature

  • PubMed ID:  10731132
  • Title:  The genome sequence of Drosophila melanogaster.
  • PubMed ID:  12537572
  • Title:  Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  • PubMed ID:  11250149
  • Title:  An evolutionarily conserved function of the Drosophila insulin receptor and insulin-like peptides in growth control.